Recombinant Yersinia pseudotuberculosis serotype O:1b UPF0391 membrane protein YpsIP31758_3502 (YpsIP31758_3502),Escherichia Coli Preis auf Anfrage

Catalog Number: CSB-EP413990YAN
Article Name: Recombinant Yersinia pseudotuberculosis serotype O:1b UPF0391 membrane protein YpsIP31758_3502 (YpsIP31758_3502),Escherichia Coli Preis auf Anfrage
Biozol Catalog Number: CSB-EP413990YAN
Supplier Catalog Number: CSB-EP413990YAN
Alternative Catalog Number: CSB-EP413990YAN-1, CSB-EP413990YAN-100, CSB-EP413990YAN-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Species Reactivity: Bacteria
Alternative Names: Recommended name: UPF0391 membrane protein YpsIP31758_3502
Tag: The tag type will be determined during production process.
UniProt: A7FMH9
Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Source: E.coli
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: MFRWGIIFLIIALIAAALGFGGLAGTAAWAAKVVFVVGIILFLISLFTGRKRL
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.