Recombinant Rotavirus A Outer capsid glycoprotein VP7

Catalog Number: CSB-EP455593RNW
Article Name: Recombinant Rotavirus A Outer capsid glycoprotein VP7
Biozol Catalog Number: CSB-EP455593RNW
Supplier Catalog Number: CSB-EP455593RNW
Alternative Catalog Number: CSB-EP455593RNW-1, CSB-EP455593RNW-100, CSB-EP455593RNW-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 38.7 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: B3SRX9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.196.
Source: E.coli
Expression System: 51-326aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QNYGINLPITGSMDTAYANSSQLDTFLTSTLCLYYPAEASTQIGDTEWKNTLSQLFLTKGWPTGSVYFKEYTDIASFSIDPQLYCDYNVVLMKYDSTLKLDMSELADLILNEWLCNPMDITLYYYQQTDEANKWIAMGQSCTIKVCPLNTQTLGIGCTTTNTATFEEVAASEKLVITDVVDGVNHKLDVTTTTCTIRNCRKLGPRENVAIIQVGGSEVLDITADPTTAPQTERMMRINWKKWWQVFYTVVDYINQ
Application Notes: Research Areas: Others