Recombinant Mesocricetus auratus Interleukin-1 (Il1a)

Catalog Number: CSB-EP4839MRG
Article Name: Recombinant Mesocricetus auratus Interleukin-1 (Il1a)
Biozol Catalog Number: CSB-EP4839MRG
Supplier Catalog Number: CSB-EP4839MRG
Alternative Catalog Number: CSB-EP4839MRG-1, CSB-EP4839MRG-100, CSB-EP4839MRG-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 32.8 kDa
Tag: N-terminal 6xHis-tagged and C-terminal Strep II-tagged
UniProt: A0A1U7Q4M0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-269aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAKVPDLFEDLKNCYSENEEYNSAIDHLSLSQKSFYDASYGSLHENCTDKFVSLRTSETSKMSSLTFEESLVMVAATSDKGKILKKRRLGFNQAFAEDDLETITRNLEETIQSDSAPYVFQSNMRYKLIRRVMQEFVLNDSLNQNIYLDADQVHLKAASLNDLQHEVKFDMYVYSSEDDSKYPVTLKISNTQLFVSAQGEDQPVLLKEMPEIPKVITGSETDLIFFWKTVNSKNYFTSAAYPELFIATKEQSQVH
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.