Recombinant Corylus avellana Non-specific lipid-transfer protein Cor a 8.0101

Catalog Number: CSB-EP4992IQL
Article Name: Recombinant Corylus avellana Non-specific lipid-transfer protein Cor a 8.0101
Biozol Catalog Number: CSB-EP4992IQL
Supplier Catalog Number: CSB-EP4992IQL
Alternative Catalog Number: CSB-EP4992IQL-1, CSB-EP4992IQL-100, CSB-EP4992IQL-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Allergen Cor a 8,Lipid transfer protein Cor a 8
Molecular Weight: 16.4 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q9ATH2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.102.
Source: E.coli
Expression System: 24-115aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK
Application Notes: Research Areas: Others