Recombinant Neisseria meningitidis serogroup B Factor H binding protein (fhbP)
Catalog Number:
CSB-EP5035NGG
- Images (0)
| Article Name: | Recombinant Neisseria meningitidis serogroup B Factor H binding protein (fhbP) |
| Biozol Catalog Number: | CSB-EP5035NGG |
| Supplier Catalog Number: | CSB-EP5035NGG |
| Alternative Catalog Number: | CSB-EP5035NGG-1, CSB-EP5035NGG-100, CSB-EP5035NGG-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | fHbp,Genome-derived Neisseria antigen 1870,GNA1870,Lipoprotein 2086,LP2086 |
| Molecular Weight: | 39.9 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | Q9JXV4 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 20-274aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | CSSGGGGVAADIGAGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ |
Product Guarantee and Expert Support
