Recombinant Mycobacterium leprae 65 kDa heat shock protein (hsp65), partial

Catalog Number: CSB-EP5061MVN
Article Name: Recombinant Mycobacterium leprae 65 kDa heat shock protein (hsp65), partial
Biozol Catalog Number: CSB-EP5061MVN
Supplier Catalog Number: CSB-EP5061MVN
Alternative Catalog Number: CSB-EP5061MVN-1, CSB-EP5061MVN-100, CSB-EP5061MVN-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 19.4 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q5U929
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-120aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VAKKTDDVAGDGTTTATVLAQALVKEGLRNVAAGANPLGLKRGIEKAVDKVTETLLKDAKEVETKEQIAATAAISAGDQSIGDLIAEAMDKVGNEGVITVEESNTFGLQLELTEGMRFDK
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.