Recombinant Escherichia coli Peptide release factor 2 (prfB)

Catalog Number: CSB-EP513364ENU
Article Name: Recombinant Escherichia coli Peptide release factor 2 (prfB)
Biozol Catalog Number: CSB-EP513364ENU
Supplier Catalog Number: CSB-EP513364ENU
Alternative Catalog Number: CSB-EP513364ENU-1, CSB-EP513364ENU-100, CSB-EP513364ENU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 48.2 kDa
Tag: C-terminal 6xHis-tagged
UniProt: C5A0G3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.121.
Source: E.coli
Expression System: 1-365aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MFEINPVNNRIQDLTERSDVLRGYLDYDAKKERLEEVNAELEQPDVWNEPERAQALGKERSSLEAVVDTLDQMKQGLEDVSGLLELAVEADDEETFNEAVAELDALEEKLAQLEFRRMFSGEYDSADCYLDIQAGSGGTEAQDWASMLERMYLRWAESRGFKTEIIEESEGEVAGIKSVTIKISGDYAYGWLRTETGVHRLVRKSPFDSGGRRHTSFSSAFVYPEVDDDIDIEINPADLRIDVYRTSGAGGQHVN
Application Notes: Research Areas: Others