Recombinant Human Flavin-containing monooxygenase 1 (FMO1), partial Preis auf Anfrage

Catalog Number: CSB-EP577163HU
Article Name: Recombinant Human Flavin-containing monooxygenase 1 (FMO1), partial Preis auf Anfrage
Biozol Catalog Number: CSB-EP577163HU
Supplier Catalog Number: CSB-EP577163HU
Alternative Catalog Number: CSB-EP577163HU-20, CSB-EP577163HU-100, CSB-EP577163HU-1
Manufacturer: Cusabio
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: Flavin-containing monooxygenase 1, EC 1.14.13.148, EC 1.14.13.8, Dimethylaniline monooxygenase [N-oxide-forming] 1, Dimethylaniline oxidase 1, Fetal hepatic flavin-containing monooxygenase 1, FMO 1, Trimethylamine monooxygenase, FMO1
Molecular Weight: /
Tag: Tag type will be determined during the manufacturing process. (Note:If you have specified tag type, please tell us or remark on your PO and we will develop the specified tag preferentially.)
UniProt: Q01740
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: Partial
Target: AKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVSNSCKEMSCYSDFPFPEDYPNYVPNSQFLEYLKMYANHFDLLKHIQFKTKVCSVTKCSDSAVSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPDIFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQNMLRNSLPTPIVTWLM
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.