Recombinant Brucella abortus OmpA-like transmembrane domain

Catalog Number: CSB-EP5775BMN
Article Name: Recombinant Brucella abortus OmpA-like transmembrane domain
Biozol Catalog Number: CSB-EP5775BMN
Supplier Catalog Number: CSB-EP5775BMN
Alternative Catalog Number: CSB-EP5775BMN-1, CSB-EP5775BMN-100, CSB-EP5775BMN-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 24.8 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q2YN33
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 24-213aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ADAIQEQPPVPAPVEVAPQYSWAGGYTGLYLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDLNPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEAKLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.