Recombinant Macaca fascicularis Inhibin subunit beta E (INHBE), partial

Catalog Number: CSB-EP5872MOVC7
Article Name: Recombinant Macaca fascicularis Inhibin subunit beta E (INHBE), partial
Biozol Catalog Number: CSB-EP5872MOVC7
Supplier Catalog Number: CSB-EP5872MOVc7
Alternative Catalog Number: CSB-EP5872MOVC7-1, CSB-EP5872MOVC7-100, CSB-EP5872MOVC7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 19.4 kDa
Tag: C-terminal 6xHis-tagged
UniProt: G7PIV1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 238-351aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TPTCEPATPLCCRRDHYVDFQELGWQDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.