Recombinant Human Malignant T-cell-amplified sequence 2 (MCTS2) Preis auf Anfrage

Catalog Number: CSB-EP587789HU
Article Name: Recombinant Human Malignant T-cell-amplified sequence 2 (MCTS2) Preis auf Anfrage
Biozol Catalog Number: CSB-EP587789HU
Supplier Catalog Number: CSB-EP587789HU
Alternative Catalog Number: CSB-EP587789HU-20, CSB-EP587789HU-100, CSB-EP587789HU-1
Manufacturer: Cusabio
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: Malignant T-cell-amplified sequence 2 MCTS2
Molecular Weight: /
Tag: Tag type will be determined during the manufacturing process. (Note:If you have specified tag type, please tell us or remark on your PO and we will develop the specified tag preferentially.)
UniProt: A0A3B3IRV3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: Full Length
Target: MFKKFDEKESVSNCIQLKTSVIKGIKSQLVEQFPGIEPWLNQIMPKKDPVKIVRCHEHTEILTVSGELLFFRQRKGPFCPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAVTAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.