Recombinant Caenorhabditis elegans Probable ubiquitin carboxyl-terminal hydrolase K02C4.3(K02C4.3),Escherichia Coli Preis auf Anfrage

Product Overview

• Article Name: Recombinant Caenorhabditis elegans Probable ubiquitin carboxyl-terminal hydrolase K02C4.3(K02C4.3),Escherichia Coli Preis auf Anfrage
• Biozol Catalog Number: CSB-EP600291CXY
• Supplier Catalog Number: CSB-EP600291CXY
• Alternative Catalog Number: CSB-EP600291CXY-1, CSB-EP600291CXY-100, CSB-EP600291CXY-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Species Reactivity: Other
• Alternative Names: Recommended name: Probable ubiquitin carboxyl-terminal hydrolase K02C4.3 EC= 3.4.19.12 Alternative name(s): Deubiquitinating enzyme Ubiquitin thioesterase Ubiquitin-specific-processing protease

Product Properties

• Tag: The tag type will be determined during production process.
• UniProt: Q09931
• Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Source: E.coli
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: MSRPKRNNNFLAPFSFNFQCGAHVNNHSLAQMVEENETGTPGTSRTVTFHDGRKLTDAEH FVFFKVKEVIADKVAEAEILESIRKRSECKPTDEQFISDIINELFYSGEPPKGRKSERFI GPLFDPEKASTASGPMDCTDVVSYDSTHPNISEISKKEEVEMQSAIQQSLASSASQNISR PTMLMSNLEDMVRNPNFSTGLYNSGNTCWLNCLSQVLYSIPKFRSILYHCAPLSWHEQPI TNVKIENQQHA

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.