Recombinant Vitis vinifera Photosystem I assembly protein Ycf4(ycf4),Escherichia Coli Preis auf Anfrage

Catalog Number: CSB-EP604527VFQ
Article Name: Recombinant Vitis vinifera Photosystem I assembly protein Ycf4(ycf4),Escherichia Coli Preis auf Anfrage
Biozol Catalog Number: CSB-EP604527VFQ
Supplier Catalog Number: CSB-EP604527VFQ
Alternative Catalog Number: CSB-EP604527VFQ-1,CSB-EP604527VFQ-100,CSB-EP604527VFQ-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Recommended name: Photosystem I assembly protein Ycf4
Tag: The tag type will be determined during production process.
UniProt: Q0ZJ09
Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Source: E.coli
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: MSWRSERIWIELITGSRKTSNFCWAFILFLGSLGFLLVGTSSYLGRNLISLFPSQQIIFF PQGIVMSFYGIAGLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRL LMKDIQSIRIAVKEDIYARRILVLYMEIRGQGAIPLTRTDENLTPREMEQKAAELAYFLR VPIEVF
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.