Recombinant Human AP-1 complex subunit beta-1 (AP1B1), partial

Catalog Number: CSB-EP604616HU
Article Name: Recombinant Human AP-1 complex subunit beta-1 (AP1B1), partial
Biozol Catalog Number: CSB-EP604616HU
Supplier Catalog Number: CSB-EP604616HU
Alternative Catalog Number: CSB-EP604616HU-1, CSB-EP604616HU-100, CSB-EP604616HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Adaptor protein complex AP-1 subunit beta-1 (Adaptor-related protein complex 1 subunit beta-1) (Beta-1-adaptin) (Beta-adaptin 1) (Clathrin assembly protein complex 1 beta large chain) (Golgi adaptor HA1/AP1 adaptin beta subunit) (ADTB1) (BAM22) (CLAPB2)
Molecular Weight: 73.3 kDa
Tag: N-terminal 6xHis-tagged and C-terminal Myc-tagged
UniProt: Q10567
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-584aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAESHPSSNLLDLNPQSINKLLTALNECTEWGQIFILDCLANYMPKDDREAQSICERVTPRLSHANSAV