Recombinant Human AP-1 complex subunit beta-1 (AP1B1), partial
Catalog Number:
CSB-EP604616HUB1
- Images (0)
| Article Name: | Recombinant Human AP-1 complex subunit beta-1 (AP1B1), partial |
| Biozol Catalog Number: | CSB-EP604616HUB1 |
| Supplier Catalog Number: | CSB-EP604616HUb1 |
| Alternative Catalog Number: | CSB-EP604616HUB1-1, CSB-EP604616HUB1-100, CSB-EP604616HUB1-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Adaptor protein complex AP-1 subunit beta-1 (Adaptor-related protein complex 1 subunit beta-1) (Beta-1-adaptin) (Beta-adaptin 1) (Clathrin assembly protein complex 1 beta large chain) (Golgi adaptor HA1/AP1 adaptin beta subunit) (ADTB1) (BAM22) (CLAPB2) |
| Molecular Weight: | 73.3 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | Q10567 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 1-584aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MTDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAESHPSSNLLDLNPQSINKLLTALNECTEWGQIFILDCLANYMPKDDREAQSICERVTPRLSHANSAV |
Product Guarantee and Expert Support
