Recombinant Human Interleukin enhancer-binding factor 2 (ILF2)

Catalog Number: CSB-EP614262HU
Article Name: Recombinant Human Interleukin enhancer-binding factor 2 (ILF2)
Biozol Catalog Number: CSB-EP614262HU
Supplier Catalog Number: CSB-EP614262HU
Alternative Catalog Number: CSB-EP614262HU-1, CSB-EP614262HU-100, CSB-EP614262HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Nuclear factor of activated T-cells 45KDA
Molecular Weight: 70.1 kDa
Tag: N-terminal GST-tagged
UniProt: Q12905
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-390aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MRGDRGRGRGGRFGSRGGPGGGFRPFVPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMN
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.