Recombinant Human Interleukin enhancer-binding factor 2 (ILF2)

Product Overview

• Article Name: Recombinant Human Interleukin enhancer-binding factor 2 (ILF2)
• Biozol Catalog Number: CSB-EP614262HU
• Supplier Catalog Number: CSB-EP614262HU
• Alternative Catalog Number: CSB-EP614262HU-1,CSB-EP614262HU-100,CSB-EP614262HU-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Species Reactivity: Human
• Alternative Names: Nuclear factor of activated T-cells 45KDA

Product Properties

• Molecular Weight: 70.1 kDa
• Tag: N-terminal GST-tagged
• UniProt: Q12905
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Expression System: 1-390aa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MRGDRGRGRGGRFGSRGGPGGGFRPFVPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMN

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.