Recombinant Human Forkhead box protein O1 (FOXO1)

Catalog Number: CSB-EP615533HU
Article Name: Recombinant Human Forkhead box protein O1 (FOXO1)
Biozol Catalog Number: CSB-EP615533HU
Supplier Catalog Number: CSB-EP615533HU
Alternative Catalog Number: CSB-EP615533HU-1, CSB-EP615533HU-100, CSB-EP615533HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Forkhead box protein O1A,Forkhead in rhabdomyosarcoma
Molecular Weight: 77.2 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q12778
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-655aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAA
Application Notes: Research Areas: Cancer