Recombinant Human Protein flightless-1 homolog (FLII), partial

Catalog Number: CSB-EP615661HUG10
Article Name: Recombinant Human Protein flightless-1 homolog (FLII), partial
Biozol Catalog Number: CSB-EP615661HUG10
Supplier Catalog Number: CSB-EP615661HUg10
Alternative Catalog Number: CSB-EP615661HUG10-1, CSB-EP615661HUG10-100, CSB-EP615661HUG10-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 85.9 kDa
Tag: N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
UniProt: Q13045
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.73.
Source: E.coli
Expression System: 495-827aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGTSLDPRFVFLLDRGLDIYVWRGAQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQELPEFWEALGGEPSEIKKHVPEDFWPPQPKLYKVGLGLGYLELPQINYKLSV
Application Notes: Research Areas: Cell Biology