Recombinant Human Interleukin-11 receptor subunit alpha (IL11RA), partial

Catalog Number: CSB-EP623927HU
Article Name: Recombinant Human Interleukin-11 receptor subunit alpha (IL11RA), partial
Biozol Catalog Number: CSB-EP623927HU
Supplier Catalog Number: CSB-EP623927HU
Alternative Catalog Number: CSB-EP623927HU-1, CSB-EP623927HU-100, CSB-EP623927HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 44.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q14626
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.149.
Source: E.coli
Expression System: 24-370aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWFRDGEPKLLQGPDSGLGHELVLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARCVVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASWTYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEE
Application Notes: Research Areas: Immunology