Recombinant Rat Zinc transporter ZIP13 (Slc39a13), partial
Catalog Number:
CSB-EP644804RA
- Images (0)
| Article Name: | Recombinant Rat Zinc transporter ZIP13 (Slc39a13), partial |
| Biozol Catalog Number: | CSB-EP644804RA |
| Supplier Catalog Number: | CSB-EP644804RA |
| Alternative Catalog Number: | CSB-EP644804RA-1, CSB-EP644804RA-100, CSB-EP644804RA-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Solute carrier family 39 member 13Zrt- and Irt-like protein 13 ,ZIP-13 |
| Molecular Weight: | 41.2 kDa |
| Tag: | N-terminal 6xHis-GST-tagged |
| UniProt: | Q2M1K6 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 130-233aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | WAYTCNISPGVEGQSLQRQQQLGLWVIAGFLTFLALEKMFLNCKEEDPSQAPSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLA |
Product Guarantee and Expert Support
