Recombinant Yersinia pestis DNA-binding protein

Catalog Number: CSB-EP6540YAS
Article Name: Recombinant Yersinia pestis DNA-binding protein
Biozol Catalog Number: CSB-EP6540YAS
Supplier Catalog Number: CSB-EP6540YAS
Alternative Catalog Number: CSB-EP6540YAS-1, CSB-EP6540YAS-100, CSB-EP6540YAS-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 27.1 kDa
Tag: C-terminal 6xHis-tagged
UniProt: O68768
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-187aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MALYNFTLTLSGVTYETEGLEDALYESGCGDAIVCAYGNSVYVEFDREAKSLDAAIASAVDNIESAGIGAIVESVDSALVGLSDVAEMTGMSRQAITMLKDGLRGGGDFPCPIQRIQGQSPLWDWADVANWLEANGRLKENAELAHNARVLSKWNLALRNSVSKDFVEIEHIASSLIARRRHHAECA
Application Notes: Research Areas: Others. Endotoxin: Not test