Recombinant Streptococcus pneumoniae Surface protein pspA (pspA), Partial

Catalog Number: CSB-EP6756SMP2
Article Name: Recombinant Streptococcus pneumoniae Surface protein pspA (pspA), Partial
Biozol Catalog Number: CSB-EP6756SMP2
Supplier Catalog Number: CSB-EP6756SMP2
Alternative Catalog Number: CSB-EP6756SMP2-1, CSB-EP6756SMP2-100, CSB-EP6756SMP2-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: pspA,spr0121
Molecular Weight: 20.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q8DRI0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 199-319aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DAEEVAPQAKIAELENQVHRLEQELKEIDESESEDYAKEGFRAPLQSKLDAKKAKLSKLEELSDKIDELDAEIAKLEDQLKAAEENNNVEDYFKEGLEKTIAAKKAELEKTEADLKKAVNE
Application Notes: Research Areas: Others