Recombinant Dog NK3 homeobox 2 (NKX3-2), partial

Catalog Number: CSB-EP7059DO
Article Name: Recombinant Dog NK3 homeobox 2 (NKX3-2), partial
Biozol Catalog Number: CSB-EP7059DO
Supplier Catalog Number: CSB-EP7059DO
Alternative Catalog Number: CSB-EP7059DO-1, CSB-EP7059DO-100, CSB-EP7059DO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Bagpipe homeobox protein homolog 1,Homeobox protein NK-3 homolog B
Molecular Weight: 28.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: A0A8I3MKP2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 125-320aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LGLGQPGCELPAAKDLEEEAAGRSDSEMSASVSGDRSPRAEDDAVGPGSARGPALCGRSGGGGGPAGGAEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPG
Application Notes: Research Areas: Others. Endotoxin: Not test