Recombinant Vespula vulgaris Venom allergen 5

Catalog Number: CSB-EP7064VET
Article Name: Recombinant Vespula vulgaris Venom allergen 5
Biozol Catalog Number: CSB-EP7064VET
Supplier Catalog Number: CSB-EP7064VET
Alternative Catalog Number: CSB-EP7064VET-1, CSB-EP7064VET-100, CSB-EP7064VET-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Allergen Ves v V,Antigen 5,Ag5,Cysteine-rich venom protein
Molecular Weight: 28.3 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: Q05110
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 24-227aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: NNYCKIKCLKGGVHTACKYGSLKPNCGNKVVVSYGLTKQEKQDILKEHNDFRQKIARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRDVAKYQVGQNVALTGSTAAKYDDPVKLVKMWEDEVKDYNPKKKFSGNDFLKTGHYTQMVWANTKEVGCGSIKYIQEKWHKHYLVCNYGPSGNFMNEELYQTK
Application Notes: Research Areas: Others. Endotoxin: Not test