Recombinant Rat NAD-dependent protein deacetylase sirtuin-2 (Sirt2)

Catalog Number: CSB-EP713049RA
Article Name: Recombinant Rat NAD-dependent protein deacetylase sirtuin-2 (Sirt2)
Biozol Catalog Number: CSB-EP713049RA
Supplier Catalog Number: CSB-EP713049RA
Alternative Catalog Number: CSB-EP713049RA-1, CSB-EP713049RA-100, CSB-EP713049RA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: NAD-dependent protein defatty-acylase sirtuin-2,Regulatory protein SIR2 homolog 2,SIR2-like protein 2
Molecular Weight: 46.2 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q5RJQ4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.224.
Source: E.coli
Expression System: 1-350aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDFLRNLFTQTLGLGSQKERLLDELTLEGVTRYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYANLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFIRLLKEKGLLLRCYTQNIDTLERVAGLEPQDLVEAHGTFYTSHCVNTSCGKEYTMSWMKEKIFSEATPKCEKCQNVVKPDIVFFGENLPPRFFSCMQSDFSKVDLLIIMGTSLQVQPFASLISKAPLATPRLLINKEKTGQ
Application Notes: Research Areas: Epigenetics and Nuclear Signaling