Recombinant Mouse Desert hedgehog protein (Dhh), partial

Catalog Number: CSB-EP720251MO
Article Name: Recombinant Mouse Desert hedgehog protein (Dhh), partial
Biozol Catalog Number: CSB-EP720251MO
Supplier Catalog Number: CSB-EP720251MO
Alternative Catalog Number: CSB-EP720251MO-1, CSB-EP720251MO-100, CSB-EP720251MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: HHG-3
Molecular Weight: 26.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q61488
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 23-198aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: CGPGRGPVGRRRYVRKQLVPLLYKQFVPSMPERTLGASGPAEGRVTRGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHIHVSVKADNSLAVRAGG
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.