Recombinant Mouse Retinal dehydrogenase 2 (Aldh1a2)

Catalog Number: CSB-EP720287MO
Article Name: Recombinant Mouse Retinal dehydrogenase 2 (Aldh1a2)
Biozol Catalog Number: CSB-EP720287MO
Supplier Catalog Number: CSB-EP720287MO
Alternative Catalog Number: CSB-EP720287MO-1, CSB-EP720287MO-100, CSB-EP720287MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: (RALDH 2)(RalDH2)(Aldehyde dehydrogenase family 1 member A2)(Retinaldehyde-specific dehydrogenase type 2)(RALDH(II)
Molecular Weight: 62.6 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q62148
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-518aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTSSEIAMPGEVKADPAALMASLQLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVCNPATGEQVCEVQEADKVDIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRATLATMESLNGGKPFLQAFYIDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGPTAGAAIASHIG
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.