Recombinant Xenopus laevis Chitinase domain-containing protein 1 (chid1)

Catalog Number: CSB-EP731568XBE
Article Name: Recombinant Xenopus laevis Chitinase domain-containing protein 1 (chid1)
Biozol Catalog Number: CSB-EP731568XBE
Supplier Catalog Number: CSB-EP731568XBE
Alternative Catalog Number: CSB-EP731568XBE-1, CSB-EP731568XBE-100, CSB-EP731568XBE-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 49.2 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q68EX9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.182.
Source: E.coli
Expression System: 20-393aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TLSKTDSKKAASKAPETKTRLSDTSVQSRGLVSTDVKAKDIVLEHRSYCAKKLKERHVSADVLGYVTPWNGHGYDIAKTFAAKFTLISSVWLQIRRKGREAYQVTGLHDVDQGWIKDIRKTSKSTQIVPRILFDGWSYQDFESVFNSEDEIEELAGAMVQTAKDEHFDGFVVEVWSQLGGQKRQELVHLLIHIGEALHSAKLHFILVIPPAVAPGTDQLGMFGRKEFDQLAPVVDSFSLMTYDYSSPQRPGPNSP
Application Notes: Research Areas: Others