Recombinant Mouse Arginase-1 (Arg1)

Catalog Number: CSB-EP733775MO
Article Name: Recombinant Mouse Arginase-1 (Arg1)
Biozol Catalog Number: CSB-EP733775MO
Supplier Catalog Number: CSB-EP733775MO
Alternative Catalog Number: CSB-EP733775MO-1, CSB-EP733775MO-100, CSB-EP733775MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Liver-type arginaseType I arginase
Molecular Weight: 50.8 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: Q61176
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-323aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYR
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.