Recombinant Human SH3 and PX domain-containing protein 2A (SH3PXD2A), partial

Catalog Number: CSB-EP735983HUC7
Article Name: Recombinant Human SH3 and PX domain-containing protein 2A (SH3PXD2A), partial
Biozol Catalog Number: CSB-EP735983HUC7
Supplier Catalog Number: CSB-EP735983HUc7
Alternative Catalog Number: CSB-EP735983HUC7-1, CSB-EP735983HUC7-100, CSB-EP735983HUC7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Adapter protein TKS5,Five SH3 domain-containing protein,SH3 multiple domains protein 1,Tyrosine kinase substrate with five SH3 domains
Molecular Weight: 15.9 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q5TCZ1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.257.
Source: E.coli
Expression System: 902-986aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: PDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSP
Application Notes: Research Areas: Others