Recombinant Rat Myosin regulatory light polypeptide 9 (Myl9) (X69Y)
Catalog Number:
CSB-EP737335RA(M)
- Images (0)
| Article Name: | Recombinant Rat Myosin regulatory light polypeptide 9 (Myl9) (X69Y) |
| Biozol Catalog Number: | CSB-EP737335RA(M) |
| Supplier Catalog Number: | CSB-EP737335RA(M) |
| Alternative Catalog Number: | CSB-EP737335RA(M)-1, CSB-EP737335RA(M)-100, CSB-EP737335RA(M)-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Myosin regulatory light chain 2, smooth muscle isoform,Myosin regulatory light chain 9 |
| Molecular Weight: | 26.6 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | Q64122 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 2-171aa(X69Y) |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | SSKRAKAKTTKKRPQSATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYRERIDKKGNFNYVEFTRILKHGAKDKDD |
Product Guarantee and Expert Support
