Recombinant Lecanicillium psalliotae Alkaline serine protease ver112

Product Overview

• Article Name: Recombinant Lecanicillium psalliotae Alkaline serine protease ver112
• Biozol Catalog Number: CSB-EP737896LCAT
• Supplier Catalog Number: CSB-EP737896LCAT
• Alternative Catalog Number: CSB-EP737896LCAT-1, CSB-EP737896LCAT-100, CSB-EP737896LCAT-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: Alkaline serine protease ver112, EC 3.4.21.-

Product Properties

• Molecular Weight: 36.0 kDa
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• UniProt: Q68GV9
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Expression System: 103-382aa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AITQQQGATWGLTRISHRARGSTAYAYDTSAGAGACVYVIDTGVEDTHPDFEGRAKQIKSYASTARDGHGHGTHCAGTIGSKTWGVAKKVSIFGVKVLDDSGSGSLSNIVAGMDFVASDRQSRNCPRRTVASMSLGGGYSAALNQAAARLQSSGVFVAVAAGNDNRDAANTSPASEPTVCTVGATDSNDVRSTFSNYGRVVDIFAPGTSITSTWIGGRTNTISGTSMATPHIAGLAAYLFGLEGGSAGAMCGRIQ

Images

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP737896LCAT could indicate that this peptide derived from E.coli-expressed Lecanicillium psalliotae (Verticillium psalliotae) N/A.