Recombinant Mouse RNA polymerase II subunit A C-terminal domain phosphatase (Ctdp1), partial

Catalog Number: CSB-EP745884MO
Article Name: Recombinant Mouse RNA polymerase II subunit A C-terminal domain phosphatase (Ctdp1), partial
Biozol Catalog Number: CSB-EP745884MO
Supplier Catalog Number: CSB-EP745884MO
Alternative Catalog Number: CSB-EP745884MO-1, CSB-EP745884MO-100, CSB-EP745884MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: TFIIF-associating CTD phosphatase
Molecular Weight: 24 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: Q7TSG2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 178-341aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: HRNRKLVLMVDLDQTLIHTTEQHCPQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFPGTGDVNAPPAARETQAR
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.