Recombinant Bovine Beta-defensin 5 (DEFB5)

Catalog Number: CSB-EP7568BOF0
Article Name: Recombinant Bovine Beta-defensin 5 (DEFB5)
Biozol Catalog Number: CSB-EP7568BOF0
Supplier Catalog Number: CSB-EP7568BOf0
Alternative Catalog Number: CSB-EP7568BOF0-1, CSB-EP7568BOF0-100, CSB-EP7568BOF0-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: BNBD-5,BNDB-5
Molecular Weight: 36.4 kDa
Tag: C-terminal GST-tagged
UniProt: P46163
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.239.
Source: E.coli
Expression System: 23-64aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QVVRNPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCRRW
Application Notes: Research Areas: Immunology