Recombinant Salmonella typhimurium ATP synthase subunit beta (atpD)

Catalog Number: CSB-EP758989SXB
Article Name: Recombinant Salmonella typhimurium ATP synthase subunit beta (atpD)
Biozol Catalog Number: CSB-EP758989SXB
Supplier Catalog Number: CSB-EP758989SXB
Alternative Catalog Number: CSB-EP758989SXB-1, CSB-EP758989SXB-100, CSB-EP758989SXB-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: ATP synthase F1 sector subunit beta,F-ATPase subunit beta
Molecular Weight: 57.2 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q7CPE2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.91.
Source: E.coli
Expression System: 1-460aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MATGKIVQVIGAVVDVEFPQDAVPRVYDALEVQNGNEKLVLEVQQQLGGGIVRTIAMGSSDGLRRGLDVKDLEHPIEVPVGKATLGRIMNVLGEPVDMKGEIGEEERWAIHRAAPSYEELSNSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLLFVDNIYRYTLAGTEV
Application Notes: Research Areas: Others