Recombinant Prunus persica Peamaclein

Catalog Number: CSB-EP7616EZK
Article Name: Recombinant Prunus persica Peamaclein
Biozol Catalog Number: CSB-EP7616EZK
Supplier Catalog Number: CSB-EP7616EZK
Alternative Catalog Number: CSB-EP7616EZK-1, CSB-EP7616EZK-100, CSB-EP7616EZK-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 13.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P86888
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.95.
Source: E.coli
Expression System: 1-63aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNPKCP
Application Notes: Research Areas: Others