Recombinant Arachis hypogaea Non-specific lipid-transfer protein

Catalog Number: CSB-EP7621ANE
Article Name: Recombinant Arachis hypogaea Non-specific lipid-transfer protein
Biozol Catalog Number: CSB-EP7621ANE
Supplier Catalog Number: CSB-EP7621ANE
Alternative Catalog Number: CSB-EP7621ANE-1, CSB-EP7621ANE-100, CSB-EP7621ANE-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 16.0 kDa
Tag: C-terminal 6xHis-tagged
UniProt: B6CEX8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.97.
Source: E.coli
Expression System: 25-116aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ISCGQVNSALAPCIPFLTKGGAPPPACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGVSIPYKISTSTNCATIKF
Application Notes: Research Areas: Others