Recombinant Human herpesvirus 6A Immediate-early protein 2 (U90/U87/U86), partial

Catalog Number: CSB-EP762358HJZ
Article Name: Recombinant Human herpesvirus 6A Immediate-early protein 2 (U90/U87/U86), partial
Biozol Catalog Number: CSB-EP762358HJZ
Supplier Catalog Number: CSB-EP762358HJZ
Alternative Catalog Number: CSB-EP762358HJZ-1, CSB-EP762358HJZ-100, CSB-EP762358HJZ-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: IE2
Molecular Weight: 27.3 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q77Z83
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1324-1500aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KQIPKKPCNEKNLKEAVYDICCNGLSNNAAIIMYFTRSKKVAQIIKIMQKELMIRPNITVSEAFKMNHAPPKYYDKDEIKRFIQLQKQGPQELWDKFENNTTHDLFTRHSDVKTMIIYAATPIDFVGAVKTCNKYAKDNPKEIVLRVCSIIDGDNPISIYNPISKEFKSKFSTLSKC
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.