Recombinant Stenotrophomonas maltophilia Thiolase

Catalog Number: CSB-EP7696FLX
Article Name: Recombinant Stenotrophomonas maltophilia Thiolase
Biozol Catalog Number: CSB-EP7696FLX
Supplier Catalog Number: CSB-EP7696FLX
Alternative Catalog Number: CSB-EP7696FLX-1, CSB-EP7696FLX-100, CSB-EP7696FLX-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 46.9 kDa
Tag: C-terminal 6xHis-tagged
UniProt: B2FPV6
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.143.
Source: E.coli
Expression System: 1-391aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSNIVIAAAKRTAIGSFLGQFNGVPTPTLGAAAIAAALEQSGVPASDVSEVLMGCVLPANLGQAPARQAAIAAGIPLSAGATTLNKVCGSGMKTIMLGHDLIKAGSASIVVAGGMESMSNAPHMLPNSRTGNRFGNFQAVDHMAHDGLVNAYDGKAMGEFAECAVDKYQFSREEQDAYAIESVKRAQAAQANGAFADEIVAVKVATRKGEVEVAIDEQPGRSDIAKIPTLRPAFKKDGSVTAASSSSISDGAAAV
Application Notes: Research Areas: Others