Recombinant Human LIM domain-binding protein 1(LDB1)

Catalog Number: CSB-EP771433HU
Article Name: Recombinant Human LIM domain-binding protein 1(LDB1)
Biozol Catalog Number: CSB-EP771433HU
Supplier Catalog Number: CSB-EP771433HU
Alternative Catalog Number: CSB-EP771433HU-1, CSB-EP771433HU-100, CSB-EP771433HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Carboxyl-terminal LIM domain-binding protein 2,LIM domain-binding factor CLIM2,Nuclear LIM interactor
Molecular Weight: 53.3 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q86U70
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.235.
Source: E.coli
Expression System: 2-411aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SVGCACPGCSSKSFKLYSPKEPPNGNAFPPFHPGTMLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMFTQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELM
Application Notes: Research Areas: Developmental Biology