Recombinant Shigella flexneri Putative multidrug resistance protein MdtA (mdtA)

Catalog Number: CSB-EP774494SZB
Article Name: Recombinant Shigella flexneri Putative multidrug resistance protein MdtA (mdtA)
Biozol Catalog Number: CSB-EP774494SZB
Supplier Catalog Number: CSB-EP774494SZB
Alternative Catalog Number: CSB-EP774494SZB-1, CSB-EP774494SZB-100, CSB-EP774494SZB-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Multidrug transporter MdtA
Molecular Weight: 44.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q83KI5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-350aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MLDNLIGARYLTGLGTITAANTVTVRSRVDGQLMALHFQEGQQVKAGDLLAEIDPSQFKVALAQTQGQLAKDKATLANARRDLARYQQLAKTNLVSRQELDAQQALVSETEGTIKADEASVASAQLQLDWSRITAPVDGRVGLKQVDVGNQISSGDTTGIVVITQTHPIDLVFTLPESDIATVVQAQKAGKPLMVEAWDRTNSKKLSEGTLLSLDNQIDATTGTIKVKARFNNQDDALFPNQFVNARMLVDTEQN
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.