Recombinant Chicken Fibroblast growth factor

Catalog Number: CSB-EP7785CHE1
Article Name: Recombinant Chicken Fibroblast growth factor
Biozol Catalog Number: CSB-EP7785CHE1
Supplier Catalog Number: CSB-EP7785CHe1
Alternative Catalog Number: CSB-EP7785CHE1-1, CSB-EP7785CHE1-100, CSB-EP7785CHE1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: FGF
Molecular Weight: 20.7 kDa
Tag: Tag-Free
UniProt: O42407
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 35-212aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: HDLGQDMLSPEATNSSSSSSSSFPSSFSSPSSAGRHVRSYNHLQGDVRKRKLYSYNKYFLKIEKNGKVSGTKKENCPFSILEITSVEIGVVAVKSIKSNYYLAMNKKGKVYGSKEFNSDCKLKERIEENGYNTYASLNWKHNGRQMFVALNGRGATKRGQKTRRKNTSAHFLPMVVMS
Application Notes: Research Areas: Others. Endotoxin: Not test