Recombinant Chicken Fibroblast growth factor (Fgf7), partial

Catalog Number: CSB-EP7786CHE1
Article Name: Recombinant Chicken Fibroblast growth factor (Fgf7), partial
Biozol Catalog Number: CSB-EP7786CHE1
Supplier Catalog Number: CSB-EP7786CHe1
Alternative Catalog Number: CSB-EP7786CHE1-1, CSB-EP7786CHE1-100, CSB-EP7786CHE1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: FGF
Molecular Weight: 19.5 kDa
Tag: Tag-Free
UniProt: Q5KRA4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 32-194aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDVRVRRLFCRTQWYMRIDKRGKVKGTREANNNYSILEIRTVAVGIVAIKGVESEYFLAMNKSGRLYGKKVCNEDCNFIELIEENHYNTYASAKWTHKGKEMFVTLNHKGVPMKGKKTKKEHRASHFLPLAIS
Application Notes: Research Areas: Developmental Biology. Endotoxin: Not test