Recombinant Human GTPase ERas (ERAS), partial

Catalog Number: CSB-EP801806HU1
Article Name: Recombinant Human GTPase ERas (ERAS), partial
Biozol Catalog Number: CSB-EP801806HU1
Supplier Catalog Number: CSB-EP801806HU1
Alternative Catalog Number: CSB-EP801806HU1-1, CSB-EP801806HU1-100, CSB-EP801806HU1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Embryonic stem cell-expressed Ras
Molecular Weight: 28.8 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q7Z444
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 3-230aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGC
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.