Recombinant Mouse Glypican-3 (Gpc3)

Catalog Number: CSB-EP804039MO
Article Name: Recombinant Mouse Glypican-3 (Gpc3)
Biozol Catalog Number: CSB-EP804039MO
Supplier Catalog Number: CSB-EP804039MO
Alternative Catalog Number: CSB-EP804039MO-1, CSB-EP804039MO-100, CSB-EP804039MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Gpc3
Molecular Weight: 29.0 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q8CFZ4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 358-553aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SAYYPEDLFIDKKILKVAHVEHEETLSSRRRELIQKLKSFINFYSALPGYICSHSPVAENDTLCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSVPKGKVLDKSLDEEGLESGDCGDDEDECIGSSGDGMVKVKNQLRFLAELAYDLDVDDAPGNKQHGNQKDNEITTSHS
Application Notes: Research Areas: Cancer. Endotoxin: Not test