Recombinant Mouse Ubiquitin-like domain-containing CTD phosphatase 1 (Ublcp1)

Catalog Number: CSB-EP805879MO
Article Name: Recombinant Mouse Ubiquitin-like domain-containing CTD phosphatase 1 (Ublcp1)
Biozol Catalog Number: CSB-EP805879MO
Supplier Catalog Number: CSB-EP805879MO
Alternative Catalog Number: CSB-EP805879MO-1, CSB-EP805879MO-100, CSB-EP805879MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Nuclear proteasome inhibitor UBLCP1
Molecular Weight: 43.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q8BGR9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 2-318aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREESLEDVLCPPPDNDDVINDFDIEDEVVEVENREENLLKVSRRVKEYKVEVLNPPREGKKLLVLDVDYTLFDHRSCAETGVELMRPYLHEFLTSAYEDYDIVIWSATNMKWIEAKMKELGVSTNANYKITFMLDSAAMITVHTPRRGLIDVKPLGVIWGKFSEFYSKKNTIMFDDIGR
Application Notes: Research Areas: Others