Recombinant Macaca fascicularis Frataxin, mitochondrial (FXN)

Catalog Number: CSB-EP810224MOV
Article Name: Recombinant Macaca fascicularis Frataxin, mitochondrial (FXN)
Biozol Catalog Number: CSB-EP810224MOV
Supplier Catalog Number: CSB-EP810224MOV
Alternative Catalog Number: CSB-EP810224MOV-1, CSB-EP810224MOV-100, CSB-EP810224MOV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: FXN, FRDA1, QnpA-13971, Frataxin, mitochondrial, Fxn, EC 1.16.3.1) [Cleaved into: Frataxin intermediate form, Frataxin mature form]
Molecular Weight: 18.2 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q8HXX9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 81-210aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SGTLGHPGSLDDTTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDRTGKNWVYSHDGVSLHELLGAELTKALKTKLDLSSLAYSGKDA
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.