Recombinant Mouse Secreted phosphoprotein 24 (Spp2)

Catalog Number: CSB-EP816975MO
Article Name: Recombinant Mouse Secreted phosphoprotein 24 (Spp2)
Biozol Catalog Number: CSB-EP816975MO
Supplier Catalog Number: CSB-EP816975MO
Alternative Catalog Number: CSB-EP816975MO-1, CSB-EP816975MO-100, CSB-EP816975MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Spp-24,Secreted phosphoprotein 2
Molecular Weight: 28 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: Q8K1I3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 24-203aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: FPVYDYDPSSLQEALSASVAKVNSQSLSPYLFRATRSSLKRVNVLDEDTLVMNLEFSVQETTCLRDSGDPSTCAFQRGYSVPTAACRSTVQMSKGQVKDVWAHCRWASSSESNSSEEMMFGDMARSHRRRNDYLLGFLSDESRSEQFRDRSLEIMRRGQPPAHRRFLNLHRRARVNSGFE