Recombinant Human Proton-coupled zinc antiporter SLC30A8 (SLC30A8), partial

Catalog Number: CSB-EP818247HU1C7
Article Name: Recombinant Human Proton-coupled zinc antiporter SLC30A8 (SLC30A8), partial
Biozol Catalog Number: CSB-EP818247HU1C7
Supplier Catalog Number: CSB-EP818247HU1c7
Alternative Catalog Number: CSB-EP818247HU1C7-1, CSB-EP818247HU1C7-100, CSB-EP818247HU1C7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Solute carrier family 30 member 8,Zinc transporter 8
Molecular Weight: 18.3 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q8IWU4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.158.
Source: E.coli
Expression System: 267-369aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LKDFSILLMEGVPKSLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCD
Application Notes: Research Areas: Others