Recombinant Avian infectious bronchitis virus Nucleoprotein (N)

Catalog Number: CSB-EP818301AHAY
Article Name: Recombinant Avian infectious bronchitis virus Nucleoprotein (N)
Biozol Catalog Number: CSB-EP818301AHAY
Supplier Catalog Number: CSB-EP818301AHAY
Alternative Catalog Number: CSB-EP818301AHAY-1, CSB-EP818301AHAY-100, CSB-EP818301AHAY-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Nucleocapsid protein,NC,Protein N
Molecular Weight: 46.1 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q8JMI6
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-409aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MASGKATGKTDAPAPVIKLGGPRPPKVGSSGNASWFQAIKAKKLNSPQPKFEGSGVPDNENLKTSQQHGYWRRQARFKPGKGGRKPVPDAWYFYYTGTGPAADLNWGDSQDGIVWVAAKGADVKSRSNQGTRDPDKFDQYPLRFSDGGPDGNFRWDFIPLNRGRSGRSTAASSAASSRPPSREGSRGRRSGSEDDLIARAAKIIQDQQKKGSRITKAKADEMAHRRYCKRTIPPGYKVDQVFGPRTKGKEGNFGD
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.